OPA1 polyclonal antibody (A01)
  • OPA1 polyclonal antibody (A01)

OPA1 polyclonal antibody (A01)

Ref: AB-H00004976-A01
OPA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant OPA1.
Información adicional
Size 50 uL
Gene Name OPA1
Gene Alias FLJ12460|KIAA0567|MGM1|NPG|NTG|largeG
Gene Description optic atrophy 1 (autosomal dominant)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OPA1 (NP_056375, 851 a.a. ~ 960 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4976

Enviar un mensaje


OPA1 polyclonal antibody (A01)

OPA1 polyclonal antibody (A01)