OMP purified MaxPab mouse polyclonal antibody (B01P)
  • OMP purified MaxPab mouse polyclonal antibody (B01P)

OMP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004975-B01P
OMP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human OMP protein.
Información adicional
Size 50 ug
Gene Name OMP
Gene Alias -
Gene Description olfactory marker protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen OMP (NP_006180.1, 1 a.a. ~ 163 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4975

Enviar un mensaje


OMP purified MaxPab mouse polyclonal antibody (B01P)

OMP purified MaxPab mouse polyclonal antibody (B01P)