OMD monoclonal antibody (M01), clone 1E10
  • OMD monoclonal antibody (M01), clone 1E10

OMD monoclonal antibody (M01), clone 1E10

Ref: AB-H00004958-M01
OMD monoclonal antibody (M01), clone 1E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant OMD.
Información adicional
Size 100 ug
Gene Name OMD
Gene Alias OSAD|SLRR2C
Gene Description osteomodulin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq YNIFNLPNIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYIFFCFPHIHTIYYGEQRSTNGQTIQLKTQVFRRF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OMD (NP_005005, 274 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4958
Clone Number 1E10
Iso type IgG3 Kappa

Enviar un mensaje


OMD monoclonal antibody (M01), clone 1E10

OMD monoclonal antibody (M01), clone 1E10