OMD MaxPab rabbit polyclonal antibody (D01)
  • OMD MaxPab rabbit polyclonal antibody (D01)

OMD MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004958-D01
OMD MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human OMD protein.
Información adicional
Size 100 uL
Gene Name OMD
Gene Alias OSAD|SLRR2C
Gene Description osteomodulin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MGFLSPIYVIFFFFGVKVHCQYETYQWDEDYDQEPDDDYQTGFPFRQNVDYGVPFHQYTLGCVSECFCPTNFPSSMYCDNRKLKTIPNIPMHIQQLYLQFNEIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLPNLLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLDLCYNYLHDSLLKDKIFAKMEKLMQLNLCSNRLESMPPGLPSSLMYLSLENNSISSIPEKYFDK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen OMD (NP_005005.1, 1 a.a. ~ 421 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4958

Enviar un mensaje


OMD MaxPab rabbit polyclonal antibody (D01)

OMD MaxPab rabbit polyclonal antibody (D01)