NR4A2 monoclonal antibody (M17), clone 3F2
  • NR4A2 monoclonal antibody (M17), clone 3F2

NR4A2 monoclonal antibody (M17), clone 3F2

Ref: AB-H00004929-M17
NR4A2 monoclonal antibody (M17), clone 3F2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NR4A2.
Información adicional
Size 100 ug
Gene Name NR4A2
Gene Alias HZF-3|NOT|NURR1|RNR1|TINUR
Gene Description nuclear receptor subfamily 4, group A, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPS*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NR4A2 (NP_006177, 147 a.a. ~ 250 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4929
Clone Number 3F2
Iso type IgG2b Kappa

Enviar un mensaje


NR4A2 monoclonal antibody (M17), clone 3F2

NR4A2 monoclonal antibody (M17), clone 3F2