NUMA1 monoclonal antibody (M01), clone 1C5
  • NUMA1 monoclonal antibody (M01), clone 1C5

NUMA1 monoclonal antibody (M01), clone 1C5

Ref: AB-H00004926-M01
NUMA1 monoclonal antibody (M01), clone 1C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NUMA1.
Información adicional
Size 100 ug
Gene Name NUMA1
Gene Alias NUMA
Gene Description nuclear mitotic apparatus protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq SPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQDLKTEK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUMA1 (NP_006176, 200 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4926
Clone Number 1C5
Iso type IgG1 Kappa

Enviar un mensaje


NUMA1 monoclonal antibody (M01), clone 1C5

NUMA1 monoclonal antibody (M01), clone 1C5