NTRK3 monoclonal antibody (M04), clone 4D5
  • NTRK3 monoclonal antibody (M04), clone 4D5

NTRK3 monoclonal antibody (M04), clone 4D5

Ref: AB-H00004916-M04
NTRK3 monoclonal antibody (M04), clone 4D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NTRK3.
Información adicional
Size 100 ug
Gene Name NTRK3
Gene Alias TRKC|gp145(trkC)
Gene Description neurotrophic tyrosine kinase, receptor, type 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq TEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NTRK3 (AAH13693, 41 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4916
Clone Number 4D5
Iso type IgG2a Kappa

Enviar un mensaje


NTRK3 monoclonal antibody (M04), clone 4D5

NTRK3 monoclonal antibody (M04), clone 4D5