NSF purified MaxPab rabbit polyclonal antibody (D01P)
  • NSF purified MaxPab rabbit polyclonal antibody (D01P)

NSF purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004905-D01P
NSF purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NSF protein.
Información adicional
Size 100 ug
Gene Name NSF
Gene Alias SKD2
Gene Description N-ethylmaleimide-sensitive factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGRSMQAARCPTDELSLTNCAVVNEKDFQSGQHVIVRTSPNHRYTFTLKTHPSVVPGSIAFSLPQRKWAGLSIGQEIEVSLYTFDKAKQCIGTMTIEIDFLQKKSIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNEKLFGLLVKDIEAMDPSILKGEPATGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NSF (AAH30613.1, 1 a.a. ~ 744 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4905

Enviar un mensaje


NSF purified MaxPab rabbit polyclonal antibody (D01P)

NSF purified MaxPab rabbit polyclonal antibody (D01P)