Ver mas grande
YBX1 polyclonal antibody (A01)
AB-H00004904-A01
Producto nuevo
YBX1 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | YBX1 |
| Gene Alias | BP-8|CSDA2|CSDB|DBPB|MDR-NF1|MGC104858|MGC110976|MGC117250|NSEP-1|NSEP1|YB-1|YB1 |
| Gene Description | Y box binding protein 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | YBX1 (NP_004550, 51 a.a. ~ 139 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 4904 |
Más información
Mouse polyclonal antibody raised against a partial recombinant YBX1.