NRF1 polyclonal antibody (A01)
  • NRF1 polyclonal antibody (A01)

NRF1 polyclonal antibody (A01)

Ref: AB-H00004899-A01
NRF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NRF1.
Información adicional
Size 50 uL
Gene Name NRF1
Gene Alias ALPHA-PAL
Gene Description nuclear respiratory factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NRF1 (NP_005002, 201 a.a. ~ 285 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4899

Enviar un mensaje


NRF1 polyclonal antibody (A01)

NRF1 polyclonal antibody (A01)