NRD1 polyclonal antibody (A01)
  • NRD1 polyclonal antibody (A01)

NRD1 polyclonal antibody (A01)

Ref: AB-H00004898-A01
NRD1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NRD1.
Información adicional
Size 50 uL
Gene Name NRD1
Gene Alias hNRD1|hNRD2
Gene Description nardilysin (N-arginine dibasic convertase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VVDKKIEEFLSSFEEKIENLTEEAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFSKSDLVNWFKAHRGPGSKMLSVHVV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NRD1 (NP_002516, 1058 a.a. ~ 1156 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4898

Enviar un mensaje


NRD1 polyclonal antibody (A01)

NRD1 polyclonal antibody (A01)