NRAS monoclonal antibody (M01), clone 2A3
  • NRAS monoclonal antibody (M01), clone 2A3

NRAS monoclonal antibody (M01), clone 2A3

Ref: AB-H00004893-M01
NRAS monoclonal antibody (M01), clone 2A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NRAS.
Información adicional
Size 100 ug
Gene Name NRAS
Gene Alias ALPS4|N-ras|NRAS1
Gene Description neuroblastoma RAS viral (v-ras) oncogene homolog
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NRAS (AAH05219, 90 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4893
Clone Number 2A3
Iso type IgG1 Kappa

Enviar un mensaje


NRAS monoclonal antibody (M01), clone 2A3

NRAS monoclonal antibody (M01), clone 2A3