SLC11A2 monoclonal antibody (M06), clone 2F7
  • SLC11A2 monoclonal antibody (M06), clone 2F7

SLC11A2 monoclonal antibody (M06), clone 2F7

Ref: AB-H00004891-M06
SLC11A2 monoclonal antibody (M06), clone 2F7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC11A2.
Información adicional
Size 100 ug
Gene Name SLC11A2
Gene Alias DCT1|DMT1|FLJ37416|NRAMP2
Gene Description solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC11A2 (NP_000608, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4891
Clone Number 2F7
Iso type IgG2a Kappa

Enviar un mensaje


SLC11A2 monoclonal antibody (M06), clone 2F7

SLC11A2 monoclonal antibody (M06), clone 2F7