NPY1R monoclonal antibody (M03), clone 2G2
  • NPY1R monoclonal antibody (M03), clone 2G2

NPY1R monoclonal antibody (M03), clone 2G2

Ref: AB-H00004886-M03
NPY1R monoclonal antibody (M03), clone 2G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NPY1R.
Información adicional
Size 100 ug
Gene Name NPY1R
Gene Alias NPYR
Gene Description neuropeptide Y receptor Y1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NPY1R (AAH36657, 1 a.a. ~ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4886
Clone Number 2G2
Iso type IgG2a Kappa

Enviar un mensaje


NPY1R monoclonal antibody (M03), clone 2G2

NPY1R monoclonal antibody (M03), clone 2G2