NPM1 monoclonal antibody (M01), clone 3B2
  • NPM1 monoclonal antibody (M01), clone 3B2

NPM1 monoclonal antibody (M01), clone 3B2

Ref: AB-H00004869-M01
NPM1 monoclonal antibody (M01), clone 3B2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NPM1.
Información adicional
Size 100 ug
Gene Name NPM1
Gene Alias B23|MGC104254|NPM
Gene Description nucleophosmin (nucleolar phosphoprotein B23, numatrin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NPM1 (AAH02398.1, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4869
Clone Number 3B2
Iso type IgG1 kappa

Enviar un mensaje


NPM1 monoclonal antibody (M01), clone 3B2

NPM1 monoclonal antibody (M01), clone 3B2