NPC1 monoclonal antibody (M02), clone 4H2
  • NPC1 monoclonal antibody (M02), clone 4H2

NPC1 monoclonal antibody (M02), clone 4H2

Ref: AB-H00004864-M02
NPC1 monoclonal antibody (M02), clone 4H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NPC1.
Información adicional
Size 100 ug
Gene Name NPC1
Gene Alias NPC
Gene Description Niemann-Pick disease, type C1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NPC1 (AAH63302, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4864
Clone Number 4H2
Iso type IgG2a Kappa

Enviar un mensaje


NPC1 monoclonal antibody (M02), clone 4H2

NPC1 monoclonal antibody (M02), clone 4H2