NPAS2 monoclonal antibody (M04), clone 3B1
  • NPAS2 monoclonal antibody (M04), clone 3B1

NPAS2 monoclonal antibody (M04), clone 3B1

Ref: AB-H00004862-M04
NPAS2 monoclonal antibody (M04), clone 3B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NPAS2.
Información adicional
Size 100 ug
Gene Name NPAS2
Gene Alias FLJ23138|MGC71151|MOP4|PASD4|bHLHe9
Gene Description neuronal PAS domain protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NPAS2 (NP_002509, 646 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4862
Clone Number 3B1
Iso type IgG2a Kappa

Enviar un mensaje


NPAS2 monoclonal antibody (M04), clone 3B1

NPAS2 monoclonal antibody (M04), clone 3B1