NPAS2 purified MaxPab mouse polyclonal antibody (B01P)
  • NPAS2 purified MaxPab mouse polyclonal antibody (B01P)

NPAS2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004862-B01P
NPAS2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NPAS2 protein.
Información adicional
Size 50 ug
Gene Name NPAS2
Gene Alias FLJ23138|MGC71151|MOP4|PASD4|bHLHe9
Gene Description neuronal PAS domain protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHNEVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHLPSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSLNPKEFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATPQFLKEMCIVDEPLEEFTSRH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NPAS2 (AAH51351.2, 1 a.a. ~ 824 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4862

Enviar un mensaje


NPAS2 purified MaxPab mouse polyclonal antibody (B01P)

NPAS2 purified MaxPab mouse polyclonal antibody (B01P)