NOTCH2 polyclonal antibody (A01)
  • NOTCH2 polyclonal antibody (A01)

NOTCH2 polyclonal antibody (A01)

Ref: AB-H00004853-A01
NOTCH2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NOTCH2.
Información adicional
Size 50 uL
Gene Name NOTCH2
Gene Alias AGS2|hN2
Gene Description Notch homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NOTCH2 (NP_077719, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4853

Enviar un mensaje


NOTCH2 polyclonal antibody (A01)

NOTCH2 polyclonal antibody (A01)