CNOT2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CNOT2 purified MaxPab rabbit polyclonal antibody (D01P)

CNOT2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004848-D01P
CNOT2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CNOT2 protein.
Información adicional
Size 100 ug
Gene Name CNOT2
Gene Alias CDC36|HSPC131|NOT2|NOT2H
Gene Description CCR4-NOT transcription complex, subunit 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVRTDGHTLSEKRNYQVTNSMFGASRKKFVEGVDSDYHDENMYYSQSSMFPHRSEKDMLASPSTSGQLSQFGASLYGQQSALGLPMRGMSNNTPQLNRSLSQGTQLPSHVTPTTGVPTMSLHTPPSPSRGILPMNPRNMMNHSQVGQGIGIPSRTNSMSSSGLGSPNRSSPSIICMPKQQPSRQPFTVNSMSGFGMNRNQAFGMNNSLSSNIFNGTDGSENVTGLDLSDFPALADRNRREGSGNPTPLINPLAGR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CNOT2 (NP_055330.1, 1 a.a. ~ 540 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4848

Enviar un mensaje


CNOT2 purified MaxPab rabbit polyclonal antibody (D01P)

CNOT2 purified MaxPab rabbit polyclonal antibody (D01P)