CNOT2 polyclonal antibody (A01)
  • CNOT2 polyclonal antibody (A01)

CNOT2 polyclonal antibody (A01)

Ref: AB-H00004848-A01
CNOT2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CNOT2.
Información adicional
Size 50 uL
Gene Name CNOT2
Gene Alias CDC36|HSPC131|NOT2|NOT2H
Gene Description CCR4-NOT transcription complex, subunit 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNOT2 (NP_055330, 441 a.a. ~ 540 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4848

Enviar un mensaje


CNOT2 polyclonal antibody (A01)

CNOT2 polyclonal antibody (A01)