NOS3 monoclonal antibody (M04), clone 1D12
  • NOS3 monoclonal antibody (M04), clone 1D12

NOS3 monoclonal antibody (M04), clone 1D12

Ref: AB-H00004846-M04
NOS3 monoclonal antibody (M04), clone 1D12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NOS3.
Información adicional
Size 100 ug
Gene Name NOS3
Gene Alias ECNOS|eNOS
Gene Description nitric oxide synthase 3 (endothelial cell)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAAT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NOS3 (AAH63294.1, 61 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4846
Clone Number 1D12
Iso type IgG2a Kappa

Enviar un mensaje


NOS3 monoclonal antibody (M04), clone 1D12

NOS3 monoclonal antibody (M04), clone 1D12