NOS3 purified MaxPab mouse polyclonal antibody (B01P)
  • NOS3 purified MaxPab mouse polyclonal antibody (B01P)

NOS3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004846-B01P
NOS3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NOS3 protein.
Información adicional
Size 50 ug
Gene Name NOS3
Gene Alias ECNOS|eNOS
Gene Description nitric oxide synthase 3 (endothelial cell)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLTQPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGDFRIWNSQLVRYAGYR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NOS3 (AAH69465.1, 1 a.a. ~ 1203 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4846

Enviar un mensaje


NOS3 purified MaxPab mouse polyclonal antibody (B01P)

NOS3 purified MaxPab mouse polyclonal antibody (B01P)