NOS1 polyclonal antibody (A01)
  • NOS1 polyclonal antibody (A01)

NOS1 polyclonal antibody (A01)

Ref: AB-H00004842-A01
NOS1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NOS1.
Información adicional
Size 50 uL
Gene Name NOS1
Gene Alias IHPS1|NOS|nNOS
Gene Description nitric oxide synthase 1 (neuronal)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq FPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEYEEWKWGKNPT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NOS1 (NP_000611, 1041 a.a. ~ 1150 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4842

Enviar un mensaje


NOS1 polyclonal antibody (A01)

NOS1 polyclonal antibody (A01)