NODAL monoclonal antibody (M09), clone 2C9
  • NODAL monoclonal antibody (M09), clone 2C9

NODAL monoclonal antibody (M09), clone 2C9

Ref: AB-H00004838-M09
NODAL monoclonal antibody (M09), clone 2C9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NODAL.
Información adicional
Size 100 ug
Gene Name NODAL
Gene Alias MGC138230
Gene Description nodal homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq CWPRPPTPPATNVLLMLYSNLSQEQRQLGGSTLLWEAESSWRAQEGQLSWEWGKRHRRHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NODAL (NP_060525.3, 180 a.a. ~ 279 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4838
Clone Number 2C9
Iso type IgG2b Kappa

Enviar un mensaje


NODAL monoclonal antibody (M09), clone 2C9

NODAL monoclonal antibody (M09), clone 2C9