NNMT purified MaxPab rabbit polyclonal antibody (D01P)
  • NNMT purified MaxPab rabbit polyclonal antibody (D01P)

NNMT purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004837-D01P
NNMT purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NNMT protein.
Información adicional
Size 100 ug
Gene Name NNMT
Gene Alias -
Gene Description nicotinamide N-methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NNMT (NP_006160.1, 1 a.a. ~ 264 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4837

Enviar un mensaje


NNMT purified MaxPab rabbit polyclonal antibody (D01P)

NNMT purified MaxPab rabbit polyclonal antibody (D01P)