NNMT polyclonal antibody (A01)
  • NNMT polyclonal antibody (A01)

NNMT polyclonal antibody (A01)

Ref: AB-H00004837-A01
NNMT polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant NNMT.
Información adicional
Size 50 uL
Gene Name NNMT
Gene Alias -
Gene Description nicotinamide N-methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NNMT (AAH00234, 1 a.a. ~ 264 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4837

Enviar un mensaje


NNMT polyclonal antibody (A01)

NNMT polyclonal antibody (A01)