NME4 purified MaxPab mouse polyclonal antibody (B01P)
  • NME4 purified MaxPab mouse polyclonal antibody (B01P)

NME4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004833-B01P
NME4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NME4 protein.
Información adicional
Size 50 ug
Gene Name NME4
Gene Alias NDPK-D|NM23H4|nm23-H4
Gene Description non-metastatic cells 4, protein expressed in
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NME4 (NP_005000.1, 1 a.a. ~ 187 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4833

Enviar un mensaje


NME4 purified MaxPab mouse polyclonal antibody (B01P)

NME4 purified MaxPab mouse polyclonal antibody (B01P)