NME3 monoclonal antibody (M13), clone 3G10
  • NME3 monoclonal antibody (M13), clone 3G10

NME3 monoclonal antibody (M13), clone 3G10

Ref: AB-H00004832-M13
NME3 monoclonal antibody (M13), clone 3G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NME3.
Información adicional
Size 100 ug
Gene Name NME3
Gene Alias DR-nm23|KIAA0516|NDPK-C|NDPKC|NM23-H3|c371H6.2
Gene Description non-metastatic cells 3, protein expressed in
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NME3 (NP_002504.2, 73 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4832
Clone Number 3G10
Iso type IgG2a Kappa

Enviar un mensaje


NME3 monoclonal antibody (M13), clone 3G10

NME3 monoclonal antibody (M13), clone 3G10