Ver mas grande
NME3 purified MaxPab rabbit polyclonal antibody (D01P)
AB-H00004832-D01P
Producto nuevo
NME3 purified MaxPab rabbit polyclonal antibody (D01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | NME3 |
| Gene Alias | DR-nm23|KIAA0516|NDPK-C|NDPKC|NM23-H3|c371H6.2 |
| Gene Description | non-metastatic cells 3, protein expressed in |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | NME3 (NP_002504.2, 1 a.a. ~ 169 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 4832 |
Más información
Rabbit polyclonal antibody raised against a full-length human NME3 protein.