NME3 polyclonal antibody (A01)
  • NME3 polyclonal antibody (A01)

NME3 polyclonal antibody (A01)

Ref: AB-H00004832-A01
NME3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant NME3.
Información adicional
Size 50 uL
Gene Name NME3
Gene Alias DR-nm23|KIAA0516|NDPK-C|NDPKC|NM23-H3|c371H6.2
Gene Description non-metastatic cells 3, protein expressed in
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NME3 (AAH00250, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4832

Enviar un mensaje


NME3 polyclonal antibody (A01)

NME3 polyclonal antibody (A01)