NME2 MaxPab rabbit polyclonal antibody (D01)
  • NME2 MaxPab rabbit polyclonal antibody (D01)

NME2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004831-D01
NME2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NME2 protein.
Información adicional
Size 100 uL
Gene Name NME2
Gene Alias MGC111212|NDPK-B|NDPKB|NM23-H2|NM23B|puf
Gene Description non-metastatic cells 2, protein (NM23B) expressed in
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NME2 (NP_002503.1, 1 a.a. ~ 152 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4831

Enviar un mensaje


NME2 MaxPab rabbit polyclonal antibody (D01)

NME2 MaxPab rabbit polyclonal antibody (D01)