NME2 polyclonal antibody (A01)
  • NME2 polyclonal antibody (A01)

NME2 polyclonal antibody (A01)

Ref: AB-H00004831-A01
NME2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant NME2.
Información adicional
Size 50 uL
Gene Name NME2
Gene Alias MGC111212|NDPK-B|NDPKB|NM23-H2|NM23B|puf
Gene Description non-metastatic cells 2, protein (NM23B) expressed in
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NME2 (AAH02476, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4831

Enviar un mensaje


NME2 polyclonal antibody (A01)

NME2 polyclonal antibody (A01)