NID1 monoclonal antibody (M01), clone 1G3
  • NID1 monoclonal antibody (M01), clone 1G3

NID1 monoclonal antibody (M01), clone 1G3

Ref: AB-H00004811-M01
NID1 monoclonal antibody (M01), clone 1G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NID1.
Información adicional
Size 100 ug
Gene Name NID1
Gene Alias NID
Gene Description nidogen 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITTALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIERK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NID1 (NP_002499.1, 1148 a.a. ~ 1247 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4811
Clone Number 1G3
Iso type IgG2a Kappa

Enviar un mensaje


NID1 monoclonal antibody (M01), clone 1G3

NID1 monoclonal antibody (M01), clone 1G3