NHP2L1 polyclonal antibody (A01)
  • NHP2L1 polyclonal antibody (A01)

NHP2L1 polyclonal antibody (A01)

Ref: AB-H00004809-A01
NHP2L1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NHP2L1.
Información adicional
Size 50 uL
Gene Name NHP2L1
Gene Alias 15.5K|FA-1|FA1|NHPX|OTK27|SNRNP15-5|SNU13|SPAG12|SSFA1
Gene Description NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NHP2L1 (AAH05358, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4809

Enviar un mensaje


NHP2L1 polyclonal antibody (A01)

NHP2L1 polyclonal antibody (A01)