Ver mas grande
NGFR monoclonal antibody (M02), clone 1H3
AB-H00004804-M02
Producto nuevo
NGFR monoclonal antibody (M02), clone 1H3
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | NGFR |
| Gene Alias | CD271|Gp80-LNGFR|TNFRSF16|p75(NTR)|p75NTR |
| Gene Description | nerve growth factor receptor (TNFR superfamily, member 16) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA |
| Immunogen Prot. Seq | EPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEEGGGGS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | NGFR (AAH50309.1, 65 a.a. ~ 148 a.a) partial recombinant protein with mouse IgG2a-Fc tag. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 4804 |
| Clone Number | 1H3 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant NGFR.