NFYC monoclonal antibody (M01), clone 1D3
  • NFYC monoclonal antibody (M01), clone 1D3

NFYC monoclonal antibody (M01), clone 1D3

Ref: AB-H00004802-M01
NFYC monoclonal antibody (M01), clone 1D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NFYC.
Información adicional
Size 50 ug
Gene Name NFYC
Gene Alias CBF-C|CBFC|DKFZp667G242|FLJ45775|H1TF2A|HAP5|HSM|NF-YC
Gene Description nuclear transcription factor Y, gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq DAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NFYC (AAH05003, 14 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4802
Clone Number 1D3
Iso type IgG3 Kappa

Enviar un mensaje


NFYC monoclonal antibody (M01), clone 1D3

NFYC monoclonal antibody (M01), clone 1D3