NFRKB polyclonal antibody (A01)
  • NFRKB polyclonal antibody (A01)

NFRKB polyclonal antibody (A01)

Ref: AB-H00004798-A01
NFRKB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NFRKB.
Información adicional
Size 50 uL
Gene Name NFRKB
Gene Alias DKFZp547B2013|INO80G
Gene Description nuclear factor related to kappaB binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FPEDSAEQQNELILALFSGENFRFGNPLHIAQKLFRDGHFNPEVVKYRQLCFKSQYKRYLNSQQQYFHRLLKQILASRSDLLEMARRSGPALPFRQKRPSPSRTPEER
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NFRKB (NP_006156, 90 a.a. ~ 197 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4798

Enviar un mensaje


NFRKB polyclonal antibody (A01)

NFRKB polyclonal antibody (A01)