NFKBIL2 polyclonal antibody (A01)
  • NFKBIL2 polyclonal antibody (A01)

NFKBIL2 polyclonal antibody (A01)

Ref: AB-H00004796-A01
NFKBIL2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NFKBIL2.
Información adicional
Size 50 uL
Gene Name NFKBIL2
Gene Alias FLJ40087|IKBR
Gene Description nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MRTRLYLNLGLTFESLQQTALCNDYFRKSIFLAEQNHLYEDLFRARYNLGTIHWRAGQHSQAMRCLEGARECAHTMRKRFMESECCVVIAQVLQDLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NFKBIL2 (NP_038460, 1 a.a. ~ 97 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4796

Enviar un mensaje


NFKBIL2 polyclonal antibody (A01)

NFKBIL2 polyclonal antibody (A01)