NFE2 monoclonal antibody (M01), clone 2C6
  • NFE2 monoclonal antibody (M01), clone 2C6

NFE2 monoclonal antibody (M01), clone 2C6

Ref: AB-H00004778-M01
NFE2 monoclonal antibody (M01), clone 2C6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant NFE2.
Información adicional
Size 100 ug
Gene Name NFE2
Gene Alias NF-E2|p45
Gene Description nuclear factor (erythroid-derived 2), 45kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPESDSGLSLNYSDAESLELEGTEAGRRRSEYVEMYPVEYPYSLMPNSLAHSNYTLPAAETPLALEPSSGPVRAKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NFE2 (AAH05044, 1 a.a. ~ 373 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4778
Clone Number 2C6
Iso type IgG2a Kappa

Enviar un mensaje


NFE2 monoclonal antibody (M01), clone 2C6

NFE2 monoclonal antibody (M01), clone 2C6