NF1 monoclonal antibody (M01), clone 2D1
  • NF1 monoclonal antibody (M01), clone 2D1

NF1 monoclonal antibody (M01), clone 2D1

Ref: AB-H00004763-M01
NF1 monoclonal antibody (M01), clone 2D1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NF1.
Información adicional
Size 100 ug
Gene Name NF1
Gene Alias DKFZp686J1293|FLJ21220|NFNS|VRNF|WSS
Gene Description neurofibromin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPTTGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NF1 (NP_000258, 2719 a.a. ~ 2818 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4763
Clone Number 2D1
Iso type IgG2a Kappa

Enviar un mensaje


NF1 monoclonal antibody (M01), clone 2D1

NF1 monoclonal antibody (M01), clone 2D1