NEUROD1 monoclonal antibody (M01), clone 3H8
  • NEUROD1 monoclonal antibody (M01), clone 3H8

NEUROD1 monoclonal antibody (M01), clone 3H8

Ref: AB-H00004760-M01
NEUROD1 monoclonal antibody (M01), clone 3H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NEUROD1.
Información adicional
Size 100 ug
Gene Name NEUROD1
Gene Alias BETA2|BHF-1|NEUROD|bHLHa3
Gene Description neurogenic differentiation 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq QDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEUROD1 (AAH09046, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4760
Clone Number 3H8
Iso type IgG2a Kappa

Enviar un mensaje


NEUROD1 monoclonal antibody (M01), clone 3H8

NEUROD1 monoclonal antibody (M01), clone 3H8