NEU2 polyclonal antibody (A01)
  • NEU2 polyclonal antibody (A01)

NEU2 polyclonal antibody (A01)

Ref: AB-H00004759-A01
NEU2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NEU2.
Información adicional
Size 50 uL
Gene Name NEU2
Gene Alias MGC129579|SIAL2
Gene Description sialidase 2 (cytosolic sialidase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEU2 (NP_005374, 180 a.a. ~ 268 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4759

Enviar un mensaje


NEU2 polyclonal antibody (A01)

NEU2 polyclonal antibody (A01)