NEU1 monoclonal antibody (M01), clone 3F9
  • NEU1 monoclonal antibody (M01), clone 3F9

NEU1 monoclonal antibody (M01), clone 3F9

Ref: AB-H00004758-M01
NEU1 monoclonal antibody (M01), clone 3F9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NEU1.
Información adicional
Size 100 ug
Gene Name NEU1
Gene Alias FLJ93471|NANH|NEU|SIAL1
Gene Description sialidase 1 (lysosomal sialidase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEU1 (NP_000425, 334 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4758
Clone Number 3F9
Iso type IgG2a Kappa

Enviar un mensaje


NEU1 monoclonal antibody (M01), clone 3F9

NEU1 monoclonal antibody (M01), clone 3F9