NEU1 polyclonal antibody (A01)
  • NEU1 polyclonal antibody (A01)

NEU1 polyclonal antibody (A01)

Ref: AB-H00004758-A01
NEU1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NEU1.
Información adicional
Size 50 uL
Gene Name NEU1
Gene Alias FLJ93471|NANH|NEU|SIAL1
Gene Description sialidase 1 (lysosomal sialidase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEU1 (NP_000425, 334 a.a. ~ 415 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4758

Enviar un mensaje


NEU1 polyclonal antibody (A01)

NEU1 polyclonal antibody (A01)