NEK3 MaxPab rabbit polyclonal antibody (D01)
  • NEK3 MaxPab rabbit polyclonal antibody (D01)

NEK3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004752-D01
NEK3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NEK3 protein.
Información adicional
Size 100 uL
Gene Name NEK3
Gene Alias HSPK36|MGC29949
Gene Description NIMA (never in mitosis gene a)-related kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP,IF
Immunogen Prot. Seq MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHPNIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMAFACTYVGTPYYVPPEIWENLPYNNKSDIWSLGCILYELCTLKHPFQANSWKNLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NEK3 (NP_002489.1, 1 a.a. ~ 506 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4752

Enviar un mensaje


NEK3 MaxPab rabbit polyclonal antibody (D01)

NEK3 MaxPab rabbit polyclonal antibody (D01)