NEK2 monoclonal antibody (M03), clone 2A10
  • NEK2 monoclonal antibody (M03), clone 2A10

NEK2 monoclonal antibody (M03), clone 2A10

Ref: AB-H00004751-M03
NEK2 monoclonal antibody (M03), clone 2A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NEK2.
Información adicional
Size 100 ug
Gene Name NEK2
Gene Alias HsPK21|NEK2A|NLK1
Gene Description NIMA (never in mitosis gene a)-related kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAAQLRAQALSDIEKNYQLKSRQILGMR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEK2 (AAH43502, 331 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4751
Clone Number 2A10
Iso type IgG2a Kappa

Enviar un mensaje


NEK2 monoclonal antibody (M03), clone 2A10

NEK2 monoclonal antibody (M03), clone 2A10