NELL1 monoclonal antibody (M03), clone 3F1
  • NELL1 monoclonal antibody (M03), clone 3F1

NELL1 monoclonal antibody (M03), clone 3F1

Ref: AB-H00004745-M03
NELL1 monoclonal antibody (M03), clone 3F1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NELL1.
Información adicional
Size 100 ug
Gene Name NELL1
Gene Alias FLJ45906|IDH3GL|NRP1
Gene Description NEL-like 1 (chicken)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NELL1 (NP_006148, 304 a.a. ~ 403 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4745
Clone Number 3F1
Iso type IgG2a Kappa

Enviar un mensaje


NELL1 monoclonal antibody (M03), clone 3F1

NELL1 monoclonal antibody (M03), clone 3F1