SEPT2 purified MaxPab mouse polyclonal antibody (B01P)
  • SEPT2 purified MaxPab mouse polyclonal antibody (B01P)

SEPT2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004735-B01P
SEPT2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SEPT2 protein.
Información adicional
Size 50 ug
Gene Name SEPT2
Gene Alias DIFF6|KIAA0158|NEDD5|Pnutl3|hNedd5
Gene Description septin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SEPT2 (NP_001008491, 1 a.a. ~ 361 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4735

Enviar un mensaje


SEPT2 purified MaxPab mouse polyclonal antibody (B01P)

SEPT2 purified MaxPab mouse polyclonal antibody (B01P)