NDUFV3 purified MaxPab rabbit polyclonal antibody (D01P)
  • NDUFV3 purified MaxPab rabbit polyclonal antibody (D01P)

NDUFV3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004731-D01P
NDUFV3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NDUFV3 protein.
Información adicional
Size 100 ug
Gene Name NDUFV3
Gene Alias CI-9KD
Gene Description NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDUFV3 (NP_001001503.1, 1 a.a. ~ 108 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4731

Enviar un mensaje


NDUFV3 purified MaxPab rabbit polyclonal antibody (D01P)

NDUFV3 purified MaxPab rabbit polyclonal antibody (D01P)